Но прежде чем перейти к описанию программы, а точнее игры, FoldIt, вернемся к методам определения структуры белка



страница5/8
Дата02.06.2018
Размер2,77 Mb.
1   2   3   4   5   6   7   8

Построение пространственной структуры белка с использованием FoldIt и Jpred

Задача: построить пространственную структуру теоретического белка длиной в 100 а.о. из Streptococcus pneumonia в программе FoldIt. Последовательность:

>R0023 SP18154A, Streptococcus pneumoniae, 100 residues

MRAQSFFLTFSFIRSKIKLALNKGVLNMIEITYIDASKNERTVTFESYEDFERSQQACLIGVADYYPVQKLTYKGHNLDYHGTYGDIFFYLMKQDLSQYN
После установки программы с сайта http://fold.it/portal/ потребовалось немалое время, чтобы разобраться с данной программой. Оказалось, что загрузить собственную последовательность не так-то и просто. Для этого нужно создать шаблон головоломки с определенным количеством аминокислотных остатков по адресу http://fold.it/portal/node/add/contest. Но ты создаешь не просто шаблон, а игру, в которую можешь пригласить других участников. Количество типов головоломок ограничено (21 штука). Скорее всего, выбранный тип головоломки вряд ли подойдет точно к поставленной задаче, хотя бы по числу аминокислотных остатков, поэтому в моем случае я выбрала позицию «Freestyle Design: Variable Length», поскольку здесь мы можем изменять заданную длину цепи и вносить мутации по остаткам.

Далее мы заходим в программу FoldIt и открываем уже подгруженную головоломку. Цепь состоит из 55 аланинов, а наша последовательность составляет 100 аминокислотных остатков. Для этого нужно выбрать “Design Mode” и вручную производить вставки по 1, 2 или 3 аминокислотным остаткам (возможно, существует другой способ, но я не нашла). Теперь необходимо мутировать аланины в нашу последовательность. Скачиваем рецепт FASTA Amino Setter, который на вход требует аминокислотную последовательность, и далее происходят нужные нам замены. Таким образом, мы подгрузили нашу последовательность. Теперь хотелось бы отобразить элементы вторичной структуры. Для этого сначала я воспользовалась программой Jpred, предсказывающей вторичные структуры, исходя из введенной последовательности.






Поделитесь с Вашими друзьями:
1   2   3   4   5   6   7   8


База данных защищена авторским правом ©grazit.ru 2017
обратиться к администрации

    Главная страница